PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027369
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 358aa    MW: 40866.9 Da    PI: 7.7427
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027369genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.8e-152168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ +a+  g++R++k+c++rw +yl
      Lus10027369 21 KGLWSPEEDEKLMNYMMSNGQGCWSDVAKNAGLHRCGKSCRLRWINYL 68
                     678*******************************************97 PP

2Myb_DNA-binding537.6e-1774117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l+v+++ +lG++ W+ Ia++m+ gRt++++k++w++
      Lus10027369  74 RGAFSPQEEDLIVHLHSLLGNR-WSQIAARMP-GRTDNEIKNFWNS 117
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-231671IPR009057Homeodomain-like
PROSITE profilePS5129416.7221668IPR017930Myb domain
SuperFamilySSF466898.59E-2919115IPR009057Homeodomain-like
SMARTSM007171.6E-122070IPR001005SANT/Myb domain
PfamPF002493.1E-142168IPR001005SANT/Myb domain
CDDcd001672.83E-92468No hitNo description
PROSITE profilePS5129425.12469123IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2572122IPR009057Homeodomain-like
SMARTSM007171.0E-1573121IPR001005SANT/Myb domain
PfamPF002491.8E-1574117IPR001005SANT/Myb domain
CDDcd001671.63E-1076119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MRNPEAKNSS NNSTTTTKVR KGLWSPEEDE KLMNYMMSNG QGCWSDVAKN AGLHRCGKSC  60
RLRWINYLRP DLKRGAFSPQ EEDLIVHLHS LLGNRWSQIA ARMPGRTDNE IKNFWNSIIK  120
KRQKSMSSSS TSPNTSDHSS MEPKKDHTMR VPPPNSLSSR TIFMEPPMFI DESSLTSLQI  180
LEDQQYHHHH HGLMNMYGHA NPYLMAPLAS MVDDHHHGVS SYGLEQGFFE KEVQVLPPLT  240
ESITIDGAHD NIRCTNHGRY SCDRSEFAST MPSSVSNFLV KKKDIDVSTK NKSKYQMWND  300
TNNNMYNNKI KNNIMGSFWQ GDHQIQDQVL GSTKVGGWDF EELMKDVSSF PFLEFQN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-252112227127MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025528.14e-97PREDICTED: transcription factor MYB46-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.12e-67myb domain protein 46